Skip to product information
Sermorelin - Research Grade
Sale price  £49.99 Regular price  £79.99

Sermorelin  - Research Grade Peptide

For research purposes only. This product is supplied exclusively for scientific laboratory research and analytical purposes. It is not intended for human or animal use, and must not be misused in any way that contravenes MHRA regulations or applicable laws.

Ultra-Pure Research Grade Peptide – Minimum 99% Purity

Supplied in sterile, flip-top headspace vials designed for laboratory use

Manufactured to exacting standards and trusted by researchers worldwide

All of our peptides are supplied strictly for research and laboratory use only. Each vial contains sterile, lyophilised powder that has been finely milled and sieved to ensure consistency. The stated weight refers to the content of a single vial. Reconstitution requires Bacteriostatic Water containing 0.9% Benzyl Alcohol (or a suitable equivalent). Please note that we do not offer any advice or recommendations regarding dosage, administration, or use in humans or animals.

Chemical Information:

  • Molecular Formula: C149H246N44O42S
  • Molecular Weight: 3358.9 g/mol
  • Purity: ≥99%
  • Sequence:YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 

You may also like

SAVE BIG WITH STACKS